Dataset for protein classical BH3-containing proteins of organism Pelusios castaneus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C8R9Q6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pelusios castaneus GN=BAD (length=187 residues).
SSRSRCSRGKKKSRLSPQSRGGGDAPGFKQPGTPTAGETPPLRLGGAGVQPPPTPPRVGQSMISKPSISFSSQSCEAELG
RTPHLWSQKLRMSQVGHSSGAAPTQPPPILWAAMRYGRELRRMSDEFDVALQVLPRPRSAGTASQLHRGSSWKETIQAWL
GHKPARDVPRKAPSDCSPPAVEMGPAP
>gnl|bcl2dbpro|A0A8C8RL12_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pelusios castaneus GN=BMF (length=193 residues).
MDPPSYLEEDYSSLDGLDDDVFHSDDFGLTGQPGEMTPTGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHAEQQDKATQT
LSPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHAPPVGFALNPHLQEEPQEGQREAHAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQILLFLHNLALNVEANRNHAGQR
>gnl|bcl2dbpro|A0A8C8SQS1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pelusios castaneus GN=BCL2L11 (length=112 residues).
MAKQPSDLNSECDREGGQFQSVERPSQPQHLRPGAPTSIQTQYQDSRCQSASIHEDMQPEIWIAQELRRIGDEFNASYCP
RRASIAFFVFPALELQRGNALDWDSPITSSEF
© 1998-2022Legal notice