Dataset for protein classical BH3-containing proteins of organism Pelusios castaneus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8SQS1_BCL2L11      MAKQPSDLNSECDREGGQFQSVERP------SQPQHLRP-GAPTS-----
A0A8C8R9Q6_BAD-01       --------SSRSRCSRGKKKSRLSPQSRGGGDAPGFKQP-GTPTAGETPP
A0A8C8RL12_BMF-01       -MDPPSYLEEDYSSLDGLDDDVFHSDDFGLTGQPGEMTPTGIFTQNQSYS
                                ..      *  ..   .      . *    * *  *      

A0A8C8SQS1_BCL2L11      --------------------------------IQTQYQDSRCQSASIHED
A0A8C8R9Q6_BAD-01       LRLG-----------GAGVQPPPTPPRVGQSMISKPSISFSSQSCEAELG
A0A8C8RL12_BMF-01       CLLGRFQLFPLTHCCGPGIRHAEQQDKATQTLSPSSSTQDVMLPCGVTEE
                                                          .   .    ..     

A0A8C8SQS1_BCL2L11      MQPEIW------------------------------------IAQELRRI
A0A8C8R9Q6_BAD-01       RTPHLWSQ---KLRMSQVGHSSGA----APTQPPPILWAAMRYGRELRRM
A0A8C8RL12_BMF-01       PQRLFYGNAGYRLHAPPVGFALNPHLQEEPQEGQREAHAEVQIARKLQCI
                            ::                                     ..:*. :

A0A8C8SQS1_BCL2L11      GDEFN-------------ASYCPRRASIAFFVF-------PALELQRGNA
A0A8C8R9Q6_BAD-01       SDEFDVALQVLPRPRSAGTASQLHRGSSWKETIQAWLGHKPARDVPRKAP
A0A8C8RL12_BMF-01       ADQFH---------RLHIQRHQQNRNQVWWQILLFLHNLALNVEANRNHA
                        .*:*                   .* .     :          :  *  .

A0A8C8SQS1_BCL2L11      LDWDSPITSSEF--
A0A8C8R9Q6_BAD-01       SDCSPPAVEMGPAP
A0A8C8RL12_BMF-01       GQR-----------
                         :            

© 1998-2022Legal notice