Dataset for protein Bmf of organism Panthera leo

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C8WD49_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Panthera leo GN=BMF (length=278 residues).
MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRSFVISIGPHFPQVEGKGERKGGVLQVRPWGR
GQHPRCLHCTPAGEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQE
DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHR
LHMQQHQQNRRRVWWQILLFLHNLALNAEENRNGAGPR
>gnl|bcl2dbpro|A0A8C8WD49_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Panthera leo GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRRRVW
WQILLFLHNLALNAEENRNGAGPR
© 1998-2022Legal notice