Dataset for protein Bmf of organism Panthera leo

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8WD49_BMF-02      MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRS
A0A8C8WD49_BMF-01      --------------------------------------------------
                                                                         

A0A8C8WD49_BMF-02      FVISIGPHFPQVEGKGERKGGVLQVRPWGRGQHPRCLHCTPAGEMEPPQC
A0A8C8WD49_BMF-01      --------------------------------------------MEPPQC
                                                                   ******

A0A8C8WD49_BMF-02      VEELEDDVFQPEDGEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCC
A0A8C8WD49_BMF-01      VEELEDDVFQPEDGEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCC
                       **************************************************

A0A8C8WD49_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A8C8WD49_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
                       **************************************************

A0A8C8WD49_BMF-02      PASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNR
A0A8C8WD49_BMF-01      PASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNR
                       **************************************************

A0A8C8WD49_BMF-02      RRVWWQILLFLHNLALNAEENRNGAGPR
A0A8C8WD49_BMF-01      RRVWWQILLFLHNLALNAEENRNGAGPR
                       ****************************

© 1998-2022Legal notice