Dataset for protein Bim of organism Pan paniscus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2R9C366_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2R9C366_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=98 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDDSAGSSLR
IALHREVQWPLKWLAKSS
© 1998-2020Legal notice