Dataset for protein Bim of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R9C366_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2R9C366_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
                        *****************************************         

A0A2R9C366_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2R9C366_BCL2L11      --------------------------------------------------
                                                                          

A0A2R9C366_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMAN---------------WD
A0A2R9C366_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDDSAGSSLRIALHREVQWP
                         ****************************** :               * 

A0A2R9C366_BCL2L11      --------
A0A2R9C366_BCL2L11      LKWLAKSS
                                

© 1998-2020Legal notice