Dataset for protein classical BH3-containing proteins of organism Oryzias sinensis

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C7WMY5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oryzias sinensis GN=BAD (length=168 residues).
MAAKFTISDDSESSEEVEGGKLDLGAAGGGGGGGEGEHLHDRHSLTLPELRLTSNGRTRLNSESTASTYSRDEDLAREDE
AGTPTDGLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSTGAAKQMLHSTSWWNYLFSHPEAEGEYS
HHESHRTE
>gnl|bcl2dbpro|A0A8C7XJP0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias sinensis GN=BMF (length=252 residues).
MDDEEDDVFELDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQRSPVERSEVPVMGSGEAWSKPQAAKTIIWLLLGVEGRLSANDNNSLINQEGGGAMKDKPQRPQALRLVSFLFQVDTFI
LVFMIISIITND
>gnl|bcl2dbpro|A0A8C7XJP0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias sinensis GN=BMF (length=241 residues).
MDDEEDDVFELDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQRSPVERSEVPVMGSGEAWSKPQAAKTIIWLLLGVEGRLSANDNNSLINQEGGGAMKDSELGVEMFISFGLSLLPHQCL
I
© 1998-2023Legal notice