Dataset for protein classical BH3-containing proteins of organism Oryzias sinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7WMY5_BAD-01      MAAKFTISDDSESSEEVEGGKLDLGA----AGGGGGGGEGEHLHDRHSLT
A0A8C7XJP0_BMF-01      ------MDDEEDDVFELDPNKWRTTARKIKCEDRGTQTPGPALVPNNGML
A0A8C7XJP0_BMF-02      ------MDDEEDDVFELDPNKWRTTARKIKCEDRGTQTPGPALVPNNGML
                             :.*:.:.  *:: .*    *    . . *    *  *  .:.: 

A0A8C7WMY5_BAD-01      LPEL--------------RLTSNGRTRLNSESTASTYSRD------EDLA
A0A8C7XJP0_BMF-01      LCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDREAERRGMERLP
A0A8C7XJP0_BMF-02      LCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDREAERRGMERLP
                       *  *              **   .*  * .:  .  :.*:      * *.

A0A8C7WMY5_BAD-01      REDEAGTPTDGLA------------------FRGRSKSAPPALWAAKKYG
A0A8C7XJP0_BMF-01      RQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWW------
A0A8C7XJP0_BMF-02      RQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWW------
                       *:: .. .*:.                    :. ....  *. *      

A0A8C7WMY5_BAD-01      QQLRRMSDEFDSLLDKG--------------EMRKVRSTGAAKQMLHSTS
A0A8C7XJP0_BMF-01      ---RLATALVSLLFDRGFIAGAGGAGQRSPVERSEVPVMGSGEAWSKPQA
A0A8C7XJP0_BMF-02      ---RLATALVSLLFDRGFIAGAGGAGQRSPVERSEVPVMGSGEAWSKPQA
                          *  :  .. *:*.*              *  :*   *:.:   :. :

A0A8C7WMY5_BAD-01      WWNYLFSHPEAEGEYSHHESHRTE--------------------------
A0A8C7XJP0_BMF-01      AKTIIWLLLGVEGRLSANDNNSLINQEGGGAMKDKPQRPQALRLVSFLFQ
A0A8C7XJP0_BMF-02      AKTIIWLLLGVEGRLSANDNNSLINQEGGGAMKDS--------------E
                        .. ::    .**  * ::.:                             

A0A8C7WMY5_BAD-01      --------------------
A0A8C7XJP0_BMF-01      VDTFILVFMIISIITND---
A0A8C7XJP0_BMF-02      LGVEMFISFGLSLLPHQCLI
                                           

© 1998-2023Legal notice