Dataset for protein classical BH3-containing proteins of organism Oreochromis aureus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A668TQU8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oreochromis aureus GN=BMF (length=123 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGECYCTDLTPARRQEIAEQQNSM
ERLPRQQPAARSVEACIGQKLQLIGDQFHWERLQLVRRMDAFG
>gnl|bcl2dbpro|A0A668V3Q4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oreochromis aureus GN=BAD (length=158 residues).
MAANFTISDSESETSEEVGEEENQQPAGQDQESKPQTLALPVIKTTGAGRLRLNSESHTSSVARDEDLMARGEDEVCTPT
EGDPFRRRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDKGEMKLKKLHHSKTWWSYLFSHQETEGENNHLENHNQRTE
© 1998-2020Legal notice