Dataset for protein classical BH3-containing proteins of organism Oreochromis aureus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A668TQU8_BMF-01      MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAE
A0A668V3Q4_BAD-01      ---------------MAANFTISDSESETSEEVG----EEENQQPAGQDQ
                                        :.*   ..*   ::  *     ::.  *.*  :

A0A668TQU8_BMF-01      EPRPL----------------FYGECYCT------DLTPARRQEIA--EQ
A0A668V3Q4_BAD-01      ESKPQTLALPVIKTTGAGRLRLNSESHTSSVARDEDLMARGEDEVCTPTE
                       *..*                 : .*.: :      ** .   :*:.   :

A0A668TQU8_BMF-01      QNSMERLPRQQPAARSVEACIGQKLQLIGDQFH-----------------
A0A668V3Q4_BAD-01      GDPFRRRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDKGEMKLKKLHHSK
                        :.: * ... *.*  .    ****. :.*:*                  

A0A668TQU8_BMF-01      --WERLQLVRRMDAFG-----------
A0A668V3Q4_BAD-01      TWWSYLFSHQETEGENNHLENHNQRTE
                         *. *   .  :. .           

© 1998-2020Legal notice