Dataset for protein Bim of organism Oncorhynchus tshawytscha

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C8F2F2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BCL2L11 (length=221 residues).
MHGQIYIYFLNSLTLILDLSYRPQNRGKSGESHPGGGAASRAEPSDNPQSCEGDQQSLGGIMIPNSLLGFQSRSPVFRTL
SRSSSGYFSFDSDSIPSSPLLKDNKSTQTPSPSSQVITHALQRMSRALETRRDYDVWPNPLRPYRASPPPTAADMRPEIL
IGQELQRIGDEFNNLFIHGRLAGRNGQVAQGNLQQMHQEPAFLLWMGLLIGRLLQIILRRR
>gnl|bcl2dbpro|A0A8C8FY48_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BCL2L11 (length=214 residues).
MSDSSRRQNQSNGSTILIERGKYGELNPGGGAASGAEPTDNPQFSEGEQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSG
YFSFDSDSIPSSPLLKDKSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPPPTAGDMWPETLIGQELQR
IGDEFNDLFIHGRLAGRNGHVAQANLQEMHQEPAFLLWMGLLIGRLLQIILQRR
© 1998-2023Legal notice