Dataset for protein Bim of organism Oncorhynchus tshawytscha

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8F2F2_BCL2L11      -MHGQIYIYFLNSLTLILDLSYRPQNRGKSGESHPGGGAASRAEPSDNPQ
A0A8C8FY48_BCL2L11      MSDSSRRQNQSNGSTILIE-------RGKYGELNPGGGAASGAEPTDNPQ
                           ..      *. *::::       *** ** :******* ***:****

A0A8C8F2F2_BCL2L11      SCEGDQQSLGGIMIPNSLLGFQSRSPVFRTLSRSSSGYFSFDSDSIPSSP
A0A8C8FY48_BCL2L11      FSEGEQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSGYFSFDSDSIPSSP
                         .**:*** ****:************:***********************

A0A8C8F2F2_BCL2L11      LLKDNKSTQTPSPSSQVITHALQRMSRALETRRDYDVWPNPLRPYRASPP
A0A8C8FY48_BCL2L11      LLKD-KSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPP
                        **** ************:********.* **.****.*****.***. **

A0A8C8F2F2_BCL2L11      PTAADMRPEILIGQELQRIGDEFNNLFIHGRLAGRNGQVAQGNLQQMHQE
A0A8C8FY48_BCL2L11      PTAGDMWPETLIGQELQRIGDEFNDLFIHGRLAGRNGHVAQANLQEMHQE
                        ***.**.** **************:************:***.***:****

A0A8C8F2F2_BCL2L11      PAFLLWMGLLIGRLLQIILRRR
A0A8C8FY48_BCL2L11      PAFLLWMGLLIGRLLQIILQRR
                        *******************.**

© 1998-2023Legal notice