Dataset for protein Bad of organism Oncorhynchus tshawytscha

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C8EXP2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BAD (length=147 residues).
MDHIHDCVDECESDHSGTTHNSEFQLHVSTTMSNRPRPGERVRLYSESQVCSQVGKRENTEFQDVMTPTEDGGGDGASFR
GRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGEPKRGISPGGGKQKVSRGWFSFLWSPKEAEGRE
>gnl|bcl2dbpro|A0A8C8GG62_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BAD (length=129 residues).
MAQMFTISDSESEPSEEVGETEKDQSSAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQELQGRGPGVEGVPTDGA
SFRGRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGVRRGSVGERRGE
>gnl|bcl2dbpro|A0A8C8H7F1_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BAD (length=156 residues).
MDHTHDCVDDNPETMNEQDESDHSGTTHYPEFQLHNVSSTRSVRPRPGGRARLYSESQVCSQVGRRDDTEFQDAITPTEE
GGGDGAPFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGVKQEVSRGWFSFLWSPNEAEGRE
>gnl|bcl2dbpro|A0A8C8H7F1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BAD (length=176 residues).
MAIINTIIHCGCPFSLQIFTMDHTHDCVDDNPETMNEQDESDHSGTTHYPEFQLHNVSSTRSVRPRPGGRARLYSESQVC
SQVGRRDDTEFQDAITPTEEGGGDGAPFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGVKQEVSR
GWFSFLWSPNEAEGRE
© 1998-2023Legal notice