Dataset for protein Bad of organism Oncorhynchus tshawytscha

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8EXP2_BAD-01      --------------------MDHIHDCVDEC--------ESDHSGTTHNS
A0A8C8GG62_BAD-01      -----------------MAQMFTISDSESEPSEEVGETEKDQSSAGKGMT
A0A8C8H7F1_BAD-02      --------------------MDHTHDCVDDNPETMNEQDESDHSGTTHYP
A0A8C8H7F1_BAD-01      MAIINTIIHCGCPFSLQIFTMDHTHDCVDDNPETMNEQDESDHSGTTHYP
                                           *    *. .:         :.: *. .  .

A0A8C8EXP2_BAD-01      EFQLH-VSTTMSNRPRPGERVRLYSESQVCSQVGKRENTEFQDVMTPTED
A0A8C8GG62_BAD-01      GGPIGHALTVPEMRLAGEGRLRMNSESQAQELQGRGPGVEGVPT------
A0A8C8H7F1_BAD-02      EFQLHNVSSTRSVRPRPGGRARLYSESQVCSQVGRRDDTEFQDAITPTEE
A0A8C8H7F1_BAD-01      EFQLHNVSSTRSVRPRPGGRARLYSESQVCSQVGRRDDTEFQDAITPTEE
                          :  . :. . *     * *: ****. .  *.  ..*   .      

A0A8C8EXP2_BAD-01      GGGDGASFRGRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGEPKRGIS
A0A8C8GG62_BAD-01      ---DGASFRGRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGVRRGSV-
A0A8C8H7F1_BAD-02      GGGDGAPFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWLDKGEPKRGIS
A0A8C8H7F1_BAD-01      GGGDGAPFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWLDKGEPKRGIS
                          ***.**.*******:*****.** ****************  . .: 

A0A8C8EXP2_BAD-01      PGGGKQKVSRGWFSFLWSPKEAEGRE
A0A8C8GG62_BAD-01      -GERRGE-------------------
A0A8C8H7F1_BAD-02      PGGVKQEVSRGWFSFLWSPNEAEGRE
A0A8C8H7F1_BAD-01      PGGVKQEVSRGWFSFLWSPNEAEGRE
                        *  . :                   

© 1998-2023Legal notice