Dataset for protein Bim of organism Oncorhynchus kisutch

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C7HIL6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L11 (length=214 residues).
MSDSSRRQNQSNGSTILIERGKYGELNPGGGAASGAEPTDNPQFSEGEQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSG
YFSFDSDSIPSSPLLKDKSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPPSTAGDMWPETLIGQELQR
IGDEFNDLFIHGRLAGRNGHVAQANLQEMHQEPAFLLWMGLLIGRLLQIILQRR
>gnl|bcl2dbpro|A0A8C7HIL6_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L11 (length=229 residues).
MTLHRQNNKNSLTLILDLSYRRQNQSNGSTILIERGKYGELNPGGGAASGAEPTDNPQFSEGEQQSRGGIMMPNSLLGFQ
SRSPLFRTLSRSSSGYFSFDSDSIPSSPLLKDKSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPPSTA
GDMWPETLIGQELQRIGDEFNDLFIHGRLAGRNGHVAQANLQEMHQEPAFLLWMGLLIGRLLQIILQRR
>gnl|bcl2dbpro|A0A8C7L4D1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L11 (length=195 residues).
FYYGESHPGGGAASRAEPSDNPQSCEGDQQSRGGIMIPNSLLGFQSRSPVFRTLSRSSSGYFSFDSDSIPSSPLLKDNKS
TQTPSPSSQVITHALQRMSRALETRRDYDVWPNPLRPYRASPPPTAADMRPEILIGQELQRIGDEFNNLFIHGRLAGRNG
QVAQGNLQQMHQEPAFLLWMGLLIGRLLQIILRRR
© 1998-2022Legal notice