Dataset for protein Bim of organism Oncorhynchus kisutch

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7HIL6_BCL2L11      MTLHRQNNKNSLTLILDLSYRRQNQSNGSTILIERGKYGELNPGGGAASG
A0A8C7HIL6_BCL2L11      ---------------MSDSSRRQNQSNGSTILIERGKYGELNPGGGAASG
A0A8C7L4D1_BCL2L11      -----------------------------------FYYGESHPGGGAASR
                                                             *** :******* 

A0A8C7HIL6_BCL2L11      AEPTDNPQFSEGEQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSGYFSFD
A0A8C7HIL6_BCL2L11      AEPTDNPQFSEGEQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSGYFSFD
A0A8C7L4D1_BCL2L11      AEPSDNPQSCEGDQQSRGGIMIPNSLLGFQSRSPVFRTLSRSSSGYFSFD
                        ***:**** .**:********:************:***************

A0A8C7HIL6_BCL2L11      SDSIPSSPLLKD-KSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPL
A0A8C7HIL6_BCL2L11      SDSIPSSPLLKD-KSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPL
A0A8C7L4D1_BCL2L11      SDSIPSSPLLKDNKSTQTPSPSSQVITHALQRMSRALETRRDYDVWPNPL
                        ************ ************:********.* **.****.*****

A0A8C7HIL6_BCL2L11      HPYRPRPPSTAGDMWPETLIGQELQRIGDEFNDLFIHGRLAGRNGHVAQA
A0A8C7HIL6_BCL2L11      HPYRPRPPSTAGDMWPETLIGQELQRIGDEFNDLFIHGRLAGRNGHVAQA
A0A8C7L4D1_BCL2L11      RPYRASPPPTAADMRPEILIGQELQRIGDEFNNLFIHGRLAGRNGQVAQG
                        .***. **.**.**.** **************:************:***.

A0A8C7HIL6_BCL2L11      NLQEMHQEPAFLLWMGLLIGRLLQIILQRR
A0A8C7HIL6_BCL2L11      NLQEMHQEPAFLLWMGLLIGRLLQIILQRR
A0A8C7L4D1_BCL2L11      NLQQMHQEPAFLLWMGLLIGRLLQIILRRR
                        ***:***********************.**

© 1998-2022Legal notice