Dataset for protein Bim of organism Oncorhynchus kisutch

[Download (right click)] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8C7HIL6_BCL2L11-02      MTLHRQNNKNSLTLILDLSYRRQNQSNGSTILIERGKYGELNPGGGAASG
A0A8C7L4D1_BCL2L11-01      -----------------------------------FYYGESHPGGGAASR
A0A8C7HIL6_BCL2L11-01      ---------------MSDSSRRQNQSNGSTILIERGKYGELNPGGGAASG
                                                                *** :******* 

A0A8C7HIL6_BCL2L11-02      AEPTDNPQFSEGEQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSGYFSFD
A0A8C7L4D1_BCL2L11-01      AEPSDNPQSCEGDQQSRGGIMIPNSLLGFQSRSPVFRTLSRSSSGYFSFD
A0A8C7HIL6_BCL2L11-01      AEPTDNPQFSEGEQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSGYFSFD
                           ***:**** .**:********:************:***************

A0A8C7HIL6_BCL2L11-02      SDSIPSSPLLKD-KSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPL
A0A8C7L4D1_BCL2L11-01      SDSIPSSPLLKDNKSTQTPSPSSQVITHALQRMSRALETRRDYDVWPNPL
A0A8C7HIL6_BCL2L11-01      SDSIPSSPLLKD-KSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPL
                           ************ ************:********:* **.****.*****

A0A8C7HIL6_BCL2L11-02      HPYRPRPPSTAGDMWPETLIGQELQRIGDEFNDLFIHGRLAGRNGHVAQA
A0A8C7L4D1_BCL2L11-01      RPYRASPPPTAADMRPEILIGQELQRIGDEFNNLFIHGRLAGRNGQVAQG
A0A8C7HIL6_BCL2L11-01      HPYRPRPPSTAGDMWPETLIGQELQRIGDEFNDLFIHGRLAGRNGHVAQA
                           :***. **.**.** ** **************:************:***.

A0A8C7HIL6_BCL2L11-02      NLQEMHQEPAFLLWMGLLIGRLLQIILQRR
A0A8C7L4D1_BCL2L11-01      NLQQMHQEPAFLLWMGLLIGRLLQIILRRR
A0A8C7HIL6_BCL2L11-01      NLQEMHQEPAFLLWMGLLIGRLLQIILQRR
                           ***:***********************:**

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice