Dataset for protein classical BH3-containing proteins of organism Nothobranchius furzeri

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1A8AQV0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Nothobranchius furzeri GN=BAD (length=166 residues).
MAAHFTISDSDSEPSEEVEEGEKKQPSAGQEESVRPHPNLPELRLPLNGRIRLNSESHVSNVSRDEDLLARVAEEEPGTP
TEGFPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMRKVRSAGSTKPMHHSRSWWNYLFSHQESDGENSHHDN
PTQRTE
© 1998-2021Legal notice