Dataset for protein classical BH3-containing proteins of organism Nothobranchius furzeri

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1A8AQV0_BAD-01      -----MAAHFTISDSDSEPSEEVEEGEKKQPSAGQEESVRPHPNL-----
A0A8C6PNJ4_BMF-01      MDDEEDDVFEPVSSCWRKTFREIKCEDRGTQTPGP--ALLPHSGMLPCGV
                              .. .:*..  :.  *::  :.   :.*   :: **..:     

A0A1A8AQV0_BAD-01      -------PELRLPLNGRIRLNSESHVSNVSRDEDLLARVAEEEPGTPTEG
A0A8C6PNJ4_BMF-01      LQHSTGNAGFRLHFPARFEIVGDFEARQQDREEE----------------
                              . :** : .*: : .:  . : .*:*:                

A0A1A8AQV0_BAD-01      FPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMRKVRSAGSTK
A0A8C6PNJ4_BMF-01      ---PNRMERPPAARSLEVCIGQKLQLIGDQFH------------------
                           .* : .*.*       *.:*. :.*:*                   

A0A1A8AQV0_BAD-01      PMHHSRSWWNYLFSHQESDGENSHHDNPTQRTE
A0A8C6PNJ4_BMF-01      -----REHLQQLWRQVAWKVPGLECYTEVTMSE
                            *.. : *: :   .  .    . .  :*

© 1998-2022Legal notice