Dataset for protein Bim of organism Nomascus leucogenys

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2I3GVB2_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=92 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEAAGSSLE
VQWPFEWLAKSS
>gnl|bcl2dbpro|A0A2I3GVB2_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
© 1998-2020Legal notice