Dataset for protein Bim of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3GVB2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2I3GVB2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                        *****************************************         

A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
                                                                          

A0A2I3GVB2_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEAAGSSLEVQWPFEWLAK
A0A2I3GVB2_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM---------ANWD------
                         ******************************         .:*       

A0A2I3GVB2_BCL2L11      SS
A0A2I3GVB2_BCL2L11      --
                          

© 1998-2020Legal notice