Dataset for protein Puma of organism Nomascus leucogenys

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2I3HWI8_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Nomascus leucogenys GN=BBC3 (length=107 residues).
MKFGMGSARACPCQVPRASSVTWVPCQICAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPS
PWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2I3HWI8_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Nomascus leucogenys GN=BBC3 (length=237 residues).
MKFGMGSARACPCQVPRASSVTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPSC
RPRRPRPAARCLPLRPHRSTRRHRRPGGPPLARGSSQPAPRPAPGRRRSHPGGSGSPRGGGTVGPGDRGPAAADGGRPQR
AVRAAETRGATAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASVGNFLCTM
>gnl|bcl2dbpro|A0A2I3HWI8_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Nomascus leucogenys GN=BBC3 (length=101 residues).
MKFGMGSARACPCQVPRASSVTWVPCQICETRGATAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDS
GGRPLPPPDTLASVGNFLCTM
© 1998-2022Legal notice