Dataset for protein Puma of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3HWI8_BBC3-02      MKFGMGSARACPCQVPRASSVTWVPCQICGPRERHGPRTPGGQLPGARRG
A0A2I3HWI8_BBC3-03      MKFGMGSARACPCQVPRASSVTWVPCQIC---------------------
A0A2I3HWI8_BBC3-01      MKFGMGSARACPCQVPRASSVTWVPCQIC---------------------
                        *****************************                     

A0A2I3HWI8_BBC3-02      PGPRRPAPLPARPPGALGSVLRPLRARPSCRPRRPRPAARCLPLRPHRST
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
                                                                          

A0A2I3HWI8_BBC3-02      RRHRRPGGPPLARGSSQPAPRPAPGRRRSHPGGSGSPRGGGTVGPGDRGP
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
                                                                          

A0A2I3HWI8_BBC3-02      AAADGGRPQRAVRAAETRGATAAPPLALEGPVQSHHGTPALTQGPQSPRD
A0A2I3HWI8_BBC3-03      ---------------AGGPTQAAP------GVRGEEEQWAREIGAQLRRM
A0A2I3HWI8_BBC3-01      ---------------ETRGATAAPPLALEGPVQSHHGTPALTQGPQSPRD
                                           : ***       *..     *   *.*  * 

A0A2I3HWI8_BBC3-02      GAQLGACTRPVDVRDSGGRPLPPPDTLASVGNFLCTM-------------
A0A2I3HWI8_BBC3-03      ADDLNA---QYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEME
A0A2I3HWI8_BBC3-01      GAQLGACTRPVDVRDSGGRPLPPPDTLASVGNFLCTM-------------
                        . :*.*     : * .  .    *..   : *::  :             

A0A2I3HWI8_BBC3-02      --
A0A2I3HWI8_BBC3-03      PN
A0A2I3HWI8_BBC3-01      --
                          

© 1998-2020Legal notice