Dataset for protein Bim of organism Nannospalax galili

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C6QXX9_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Nannospalax galili GN=BCL2L11 (length=84 residues).
MAKQPSDVSSECDREGGQLQPAERPAQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMELKNLNLCS
LQAK
>gnl|bcl2dbpro|A0A8C6QXX9_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Nannospalax galili GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPAQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEE
PADIRPEIWIAQELRRIGDEFNASYPRRVFLNNYQADEDHPQMVILQLLRFIVRLVWRRH
>gnl|bcl2dbpro|A0A8C6QXX9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Nannospalax galili GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPAQLRPGAPTSLQTEQQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPADIRPEIWIAQELRRIGDEFNAS
YPRRVFLNNYQADEDHPQMVILQLLRFIVRLVWRRH
© 1998-2022Legal notice