Dataset for protein Bim of organism Nannospalax galili

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6QXX9_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPAQLRPGAPTSLQTEQQ---------
A0A8C6QXX9_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPAQLRPGAPTSLQTEQQ---------
A0A8C6QXX9_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPAQLRPGAPTSLQTEQQGNPEGEGDR
                        *****************************************         

A0A8C6QXX9_BCL2L11      -----------------------------------------------DRS
A0A8C6QXX9_BCL2L11      -----------------------------------------------DRS
A0A8C6QXX9_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
                                                                       ***

A0A8C6QXX9_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAM---------------------EL
A0A8C6QXX9_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPADIRPEIWIAQEL
A0A8C6QXX9_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPADIRPEIWIAQEL
                        ***************************                     **

A0A8C6QXX9_BCL2L11      KNLN------------LCSLQAK-----------------------
A0A8C6QXX9_BCL2L11      RRIGDEFNASYPRRVFLNNYQADEDHPQMVILQLLRFIVRLVWRRH
A0A8C6QXX9_BCL2L11      RRIGDEFNASYPRRVFLNNYQADEDHPQMVILQLLRFIVRLVWRRH
                        ..:.            * . **.                       

© 1998-2022Legal notice