Dataset for protein classical BH3-containing proteins of organism Naja naja

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C6VCH5_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Naja naja GN=BMF (length=193 residues).
MDPPVYLEDDFSHLDGLDDDVFHSDDCELVSQSSKMAFRGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRHAKQQDKATQT
LNASSSSQDIMLPCGVTEEPQRLFYGNAGYRLHVQPIGFTLNPHLQEEPQESLQELRTEVQIARKLQCIADQFHRLHLQR
HQQNRNQVWWQILLFLHNLALNVEANRQRVGQR
>gnl|bcl2dbpro|A0A8C6VCH5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Naja naja GN=BMF (length=223 residues).
MQGQEIGEMDPPVYLEDDFSHLDGLDDDVFHSDDCELVSQSSKMAFRGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRHAK
QQDKATQTLNASSSSQDIMLPCGVTEEPQRLFYGNAGYRLHVQPIGFTLNPHLQEEPQESLQELRTEVQIARKLQCIADQ
FHRLHLQRHLLWTIEGSAAAIHNLAVSRYVHQQNRNQVWWQILLFLHNLALNVEANRQRVGQR
>gnl|bcl2dbpro|A0A8C6VCH5_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Naja naja GN=BMF (length=215 residues).
MDPPVYLEDDFSHLDGLDDDVFHSDDCELVSQSSKMAFRGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRHAKQQDKATQT
LNASSSSQDIMLPCGVTEEPQRLFYGNAGYRLHVQPIGFTLNPHLQEEPQESLQELRTEVQIARKLQCIADQFHRLHLQR
HLLWTIEGSAAAIHNLAVSRYVHQQNRNQVWWQILLFLHNLALNVEANRQRVGQR
>gnl|bcl2dbpro|A0A8C6VGF4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Naja naja GN=BCL2L11 (length=202 residues).
MAKQSSDLNSECEREGGQLQPAERPAQPHHLRPGAPTSLQTEYQGNHLGERDSSSPGSPQGPLAPPSSPSPFATRSPLFM
FVRRSPLLSRSSSGYFSFDIDRSPAPMNCDKATQTPSPPCQAINHYLSAMGKQEHASRWQSRPIPEDMQPEIWIAQELRR
IGDEFNASYCPRRGLLDYQGVNHQIIILRLLHYIVRFIWRMQ
>gnl|bcl2dbpro|A0A8C6Y3T4_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Naja naja GN=PMAIP1 (length=51 residues).
LPGKFFRRYFQQQHTTRCSALIALQLRRIGDKWNLQQRILNLFSKLFCPGT
© 1998-2022Legal notice