Dataset for protein classical BH3-containing proteins of organism Naja naja

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6Y3T4_PMAIP1-      ----------------------------------LPGKF-----------
A0A8C6VGF4_BCL2L11      MAKQSSDLNSECEREGGQLQPAERPAQPHHLRPGAPTSLQTEYQGNHLGE
A0A8C6VCH5_BMF-03       ------------------MDPPVYLEDDFSHLDGLDDDV---FHSDDCEL
A0A8C6VCH5_BMF-01       ----------MQGQEIGEMDPPVYLEDDFSHLDGLDDDV---FHSDDCEL
A0A8C6VCH5_BMF-02       ------------------MDPPVYLEDDFSHLDGLDDDV---FHSDDCEL
                                                             ..           

A0A8C6Y3T4_PMAIP1-      --------FRRYFQQQHTTRC-----------------------------
A0A8C6VGF4_BCL2L11      RDSSSPGSPQGPLAPPSSPSPFATRSPLFMFVRRSPLLSRSSSGYFSFDI
A0A8C6VCH5_BMF-03       VSQSSKMAFRGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRHAK-----QQ
A0A8C6VCH5_BMF-01       VSQSSKMAFRGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRHAK-----QQ
A0A8C6VCH5_BMF-02       VSQSSKMAFRGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRHAK-----QQ
                                 .  :    :                                

A0A8C6Y3T4_PMAIP1-      --------------------------------------------------
A0A8C6VGF4_BCL2L11      DRSPAPMNCDKATQTPSPPCQAINH----YLSAMGKQEHASRW-------
A0A8C6VCH5_BMF-03       DKATQTLNASSSSQDIMLPCGVTEEPQRLFYGNAGYRLHVQPIGFTLNPH
A0A8C6VCH5_BMF-01       DKATQTLNASSSSQDIMLPCGVTEEPQRLFYGNAGYRLHVQPIGFTLNPH
A0A8C6VCH5_BMF-02       DKATQTLNASSSSQDIMLPCGVTEEPQRLFYGNAGYRLHVQPIGFTLNPH
                                                                          

A0A8C6Y3T4_PMAIP1-      --------------SALIALQLRRIGDKWNLQQ-----------------
A0A8C6VGF4_BCL2L11      ---QSRPIPEDMQPEIWIAQELRRIGDEFNASYCPRRGLLDYQGV-----
A0A8C6VCH5_BMF-03       LQEEPQESLQELRTEVQIARKLQCIADQFHRLHLQR--------------
A0A8C6VCH5_BMF-01       LQEEPQESLQELRTEVQIARKLQCIADQFHRLHLQRHLLWTIEGSAAAIH
A0A8C6VCH5_BMF-02       LQEEPQESLQELRTEVQIARKLQCIADQFHRLHLQRHLLWTIEGSAAAIH
                                      .  ** :*. *.*:::                    

A0A8C6Y3T4_PMAIP1-      ------------------RILNLFSKLFCPGT---------
A0A8C6VGF4_BCL2L11      -----------NHQIIILRLLHYIVRFIWRMQ---------
A0A8C6VCH5_BMF-03       --------HQQNRNQVWWQILLFLHNLALNVEANRQRVGQR
A0A8C6VCH5_BMF-01       NLAVSRYVHQQNRNQVWWQILLFLHNLALNVEANRQRVGQR
A0A8C6VCH5_BMF-02       NLAVSRYVHQQNRNQVWWQILLFLHNLALNVEANRQRVGQR
                                          .:*  : .:              

© 1998-2022Legal notice