Dataset for protein Bim of organism Mus spicilegus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C6HGQ3_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Mus spicilegus GN=BCL2L11 (length=214 residues).
MIPAAAGAARARGAARETFGSPAERGGGRTGRRGALEPRTRLCFPCLLGGDVQGSFDRRNTPRSEGKGRTKKDQMAKQPS
DVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRP
EIRIAQELRRIGDEFNETYTRRVRTSPHPQRKCDCGDMAPFCTLRYLSPNSALT
>gnl|bcl2dbpro|A0A8C6HGQ3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Mus spicilegus GN=BCL2L11 (length=224 residues).
MILKLNLLKIIVLLCPPPTLFPCRKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCP
HGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQ
SQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|A0A8C6HGQ3_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Mus spicilegus GN=BCL2L11 (length=270 residues).
MIPAAAGAARARGAARETFGSPAERGGGRTGRRGALEPRTRLCFPCLLGGDVQGSFDRRNTPRSEGKGRTKKDQMAKQPS
DVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLS
RSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVR
TSPHPQRKCDCGDMAPFCTLRYLSPNSALT
© 1998-2022Legal notice