Dataset for protein Bim of organism Mus spicilegus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6HGQ3_BCL2L11      ----------------------------MILKLNLLKIIVLLCPPPTLFP
A0A8C6HGQ3_BCL2L11      MIPAAAGAARARGAARETFGSPAERGGGRTGRRGALEPRTRLC-----FP
A0A8C6HGQ3_BCL2L11      MIPAAAGAARARGAARETFGSPAERGGGRTGRRGALEPRTRLC-----FP
                                                       . . *:  . **     **

A0A8C6HGQ3_BCL2L11      C-----------------------RKKDQMAKQPSDVSSECDREGGQLQP
A0A8C6HGQ3_BCL2L11      CLLGGDVQGSFDRRNTPRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQP
A0A8C6HGQ3_BCL2L11      CLLGGDVQGSFDRRNTPRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQP
                        *                        *************************

A0A8C6HGQ3_BCL2L11      AERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFAT
A0A8C6HGQ3_BCL2L11      AERPPQLRPGAPTSLQTEPQ------------------------------
A0A8C6HGQ3_BCL2L11      AERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFAT
                        ********************                              

A0A8C6HGQ3_BCL2L11      RSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
A0A8C6HGQ3_BCL2L11      --------------------------DRSPAPMSCDKSTQTPSPPCQAFN
A0A8C6HGQ3_BCL2L11      RSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
                                                  ************************

A0A8C6HGQ3_BCL2L11      HYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYR
A0A8C6HGQ3_BCL2L11      HYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVRTSPHP
A0A8C6HGQ3_BCL2L11      HYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVRTSPHP
                        ******************************************** :. : 

A0A8C6HGQ3_BCL2L11      ----EAEDHPQMVILQLLRFIFRLVWRRH
A0A8C6HGQ3_BCL2L11      QRKCDCGDMAPFCTLRYLSPNSALT----
A0A8C6HGQ3_BCL2L11      QRKCDCGDMAPFCTLRYLSPNSALT----
                            :. * . :  *. *     *.    

© 1998-2022Legal notice