Dataset for protein Bmf of organism Mus musculus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A2AV74_BMF-06 Bcl2 modifying factor protein OS=[Eukaryota] Mus musculus GN=BMF (length=185 residues).
MEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQNRDRA
WWQVFLFLQNLALNRQENREGVGPW
>gnl|bcl2dbpro|A2AV74_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mus musculus GN=BMF (length=271 residues).
MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPIECGHQAPRVFFTLDPGAEPWHHNSEAETLS
WSHPGEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLS
PASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQ
QNRDRAWWQVFLFLQNLALNRQENREGVGPW
>gnl|bcl2dbpro|A2AV74_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Mus musculus GN=BMF (length=190 residues).
MSPGEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQ
NRDRAWWQVFLFLQNLALNRQENREGVGPW
© 1998-2020Legal notice