Dataset for protein Bmf of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q91ZE9_BMF-02      ------------------------------------------------------------
Q91ZE9_BMF-01      MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPIECGHQAPRVF
Q91ZE9_BMF-06      ------------------------------------------------------------
                                                                               

Q91ZE9_BMF-02      ---------------------MSPGEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADL
Q91ZE9_BMF-01      FTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADL
Q91ZE9_BMF-06      --------------------------MEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADL
                                             **********************************

Q91ZE9_BMF-02      FAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQR
Q91ZE9_BMF-01      FAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQR
Q91ZE9_BMF-06      FAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQR
                   ************************************************************

Q91ZE9_BMF-02      LFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQ
Q91ZE9_BMF-01      LFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQ
Q91ZE9_BMF-06      LFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQ
                   ************************************************************

Q91ZE9_BMF-02      QNRDRAWWQVFLFLQNLALNRQENREGVGPW
Q91ZE9_BMF-01      QNRDRAWWQVFLFLQNLALNRQENREGVGPW
Q91ZE9_BMF-06      QNRDRAWWQVFLFLQNLALNRQENREGVGPW
                   *******************************

© 1998-2022Legal notice