Dataset for protein Noxa of organism Moschus moschiferus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C6CNS6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Moschus moschiferus GN=PMAIP1 (length=54 residues).
MPGRRARRSAQLSPARVPADPEVECAIQLRRIGDKLNFRQKLVNLISKLLRSGT
>gnl|bcl2dbpro|A0A8C6D4Q6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Moschus moschiferus GN=PMAIP1 (length=54 residues).
MPGRRARRSAQPSPARDQRDPEVECAIQLRRIGDKLNFRQKLVNLISKLLRSGT
>gnl|bcl2dbpro|A0A8C6ECQ4_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Moschus moschiferus GN=PMAIP1 (length=54 residues).
MPGRRARRSAQPSPTRVPADPEVECAIQWRRIGDKLNFRQKLVNLISKLLRSGT
>gnl|bcl2dbpro|A0A8C6FY79_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Moschus moschiferus GN=PMAIP1 (length=54 residues).
MPGRRSRRSAQPSPARVAADPEVECAIQLRRIGDKLNFRQKLVNLISKLLRSGT
© 1998-2022Legal notice