Dataset for protein Noxa of organism Moschus moschiferus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6ECQ4_PMAIP1-      MPGRRARRSAQPSPTRVPADPEVECAIQWRRIGDKLNFRQKLVNLISKLL
A0A8C6CNS6_PMAIP1-      MPGRRARRSAQLSPARVPADPEVECAIQLRRIGDKLNFRQKLVNLISKLL
A0A8C6FY79_PMAIP1-      MPGRRSRRSAQPSPARVAADPEVECAIQLRRIGDKLNFRQKLVNLISKLL
A0A8C6D4Q6_PMAIP1-      MPGRRARRSAQPSPARDQRDPEVECAIQLRRIGDKLNFRQKLVNLISKLL
                        *****:***** **:*   ********* *********************

A0A8C6ECQ4_PMAIP1-      RSGT
A0A8C6CNS6_PMAIP1-      RSGT
A0A8C6FY79_PMAIP1-      RSGT
A0A8C6D4Q6_PMAIP1-      RSGT
                        ****

© 1998-2022Legal notice