Dataset for protein Bim of organism Monodelphis domestica

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|F7CXT2_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Monodelphis domestica GN=BCL2L11 (length=205 residues).
MAKQPSDLNSECDREGGQLQPTERPTQPQQLRPGAPTSIQTQYQGNSGEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIF
LRRSPLLPRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHASMRQSQSIPADMRPEIWIAQELRRI
GDEFNASYYPRRGFLDNNYQGAGDHHQMVILRLLRYIIRLVWRMQ
>gnl|bcl2dbpro|F7CXT2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Monodelphis domestica GN=BCL2L11 (length=129 residues).
MAKQPSDLNSECDREGGQLQPTERPTQPQQLRPGAPTSIQTQYQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQS
QSIPADMRPEIWIAQELRRIGDEFNASYYPRRAVWHCFKSFGIGVGSQL
© 1998-2020Legal notice