Dataset for protein Bim of organism Monodelphis domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7CXT2_BCL2L11-02      MAKQPSDLNSECDREGGQLQPTERPTQPQQLRPGAPTSIQTQYQGNSGEG
F7CXT2_BCL2L11-01      MAKQPSDLNSECDREGGQLQPTERPTQPQQLRPGAPTSIQTQYQ------
                       ********************************************      

F7CXT2_BCL2L11-02      DSCSPSSPQGPFAPPTSPSPFATRSPLFIFLRRSPLLPRSSSGYFSFDTD
F7CXT2_BCL2L11-01      -------------------------------------------------D
                                                                        *

F7CXT2_BCL2L11-02      RSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHASMRQSQSIPADMRPE
F7CXT2_BCL2L11-01      RSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQSIPADMRPE
                       *****************************     ****************

F7CXT2_BCL2L11-02      IWIAQELRRIGDEFNASYYPRRGFLDN-NYQGAGDHHQMVILRLLRYIIR
F7CXT2_BCL2L11-01      IWIAQELRRIGDEFNASYYPRRAVWHCFKSFGIGVGSQL-----------
                       **********************..    :  * *   *:           

F7CXT2_BCL2L11-02      LVWRMQ
F7CXT2_BCL2L11-01      ------
                             

© 1998-2020Legal notice