Dataset for protein Bim of organism Monodelphis domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F8H037_BCL2L11      MAKQPSDLNSECDREGGQLQPTERPTQPQQLRPGAPTSIQTQYQ------
A0A5F8H037_BCL2L11      MAKQPSDLNSECDREGGQLQPTERPTQPQQLRPGAPTSIQTQYQGNSGEG
                        ********************************************      

A0A5F8H037_BCL2L11      -------------------------------------------------D
A0A5F8H037_BCL2L11      DSCSPSSPQGPFAPPTSPSPFATRSPLFIFLRRSPLLPRSSSGYFSFDTD
                                                                         *

A0A5F8H037_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQSIPADMRPE
A0A5F8H037_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHASMRQSQSIPADMRPE
                        *****************************     ****************

A0A5F8H037_BCL2L11      IWIAQELRRIGDEFNASYYPRRAVWHCFKSFGIGVGSQL-----------
A0A5F8H037_BCL2L11      IWIAQELRRIGDEFNASYYPRRGFLDN-NYQGAGDHHQMVILRLLRYIIR
                        **********************..    :  * *   *:           

A0A5F8H037_BCL2L11      ------
A0A5F8H037_BCL2L11      LVWRMQ
                              

© 1998-2021Legal notice