Dataset for protein Bim of organism Mandrillus leucophaeus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5Z7V3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5Z7V3_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L11 (length=111 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
SSLFGFIFTGLDLYGHHHSQDTEQLNHKDFS
© 1998-2020Legal notice