Dataset for protein Bim of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5Z7V3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5Z7V3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
                        *****************************************         

A0A2K5Z7V3_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
                                                                          

A0A2K5Z7V3_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A2K5Z7V3_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVI----------------
                         ******************************.                  

A0A2K5Z7V3_BCL2L11      ELRRIGD-EFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A2K5Z7V3_BCL2L11      -LEDIGDSSLFGFIFTGLDLYGHHHSQDTEQLNHKDFS-----------
                         *  *** .: .:    : * .:: ::*  *:    :            

© 1998-2020Legal notice