Dataset for protein classical BH3-containing proteins of organism Malurus cyaneus samueli

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C5THT3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Malurus cyaneus samueli GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNAEVNRNHTGQR
>gnl|bcl2dbpro|A0A8C5TVU9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Malurus cyaneus samueli GN=BCL2L11 (length=83 residues).
TYKSNCEFYGVQSVQFVLALGSNAPTLSHAASRWQSHSPAEEVQPEIWIAQELRRIGDEFNASYCPRRVTFLSSLSISLK
GKG
>gnl|bcl2dbpro|A0A8C5UI47_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Malurus cyaneus samueli GN=BCL2L11 (length=217 residues).
MGRGAGGRAGPGALGRSPRSAPRRQPDGQAAPEVKARRDGEGGRLPAAEGRARARSCARRPRRLPGPGRPGVAAAAARGP
PTGPFATRSPLFIFVRRSPLLPRSSSGYFSFEAERSPAPLGCDKATQTPSPPCQALSHCLSAMASRWQSHSPAEEVQPEI
WIAQELSSLLCLVFLSFLFCFVFLPLFQGFLDFQVGNPQVVILRLLRYIIRLIWRLQ
© 1998-2022Legal notice