Dataset for protein classical BH3-containing proteins of organism Malurus cyaneus samueli

[Download (right click)] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8C5THT3_BMF-01          MDRPSYLEEDYSSLDGLDDDVF----------------------------
A0A8C5UI47_BCL2L11-01      MGRGAGGRAGPGALGRSPRSAPRRQPDGQAAPEVKARRDGEGGRLPAAEG
A0A8C5TVU9_BCL2L11-01      --------------------------------------------------
                                                                             

A0A8C5THT3_BMF-01          ---------------HSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQL
A0A8C5UI47_BCL2L11-01      RARARSCARRPRRLPGPGRPGVAAAAARGPPTGPFATRSPLFIFVRRSPL
A0A8C5TVU9_BCL2L11-01      --------------------------------------------------
                                                                             

A0A8C5THT3_BMF-01          FPLTHCCGP---GIR--HPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRR
A0A8C5UI47_BCL2L11-01      LPRSSSGYFSFEAERSPAPLGCDKATQTPSPPCQALSHCL----------
A0A8C5TVU9_BCL2L11-01      TYKSNCEFYGVQSVQFVLALGSNAPT-------------L----------
                              : .      . :   .   : .*             *          

A0A8C5THT3_BMF-01          LFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIADQ
A0A8C5UI47_BCL2L11-01      -SAMASRWQSHSP-----------------AEEVQPEIWIAQELSSLL--
A0A8C5TVU9_BCL2L11-01      -SHAASRWQSHSP-----------------AEEVQPEIWIAQELRRIGDE
                               :: :: * *                  .*.:.*: **::*  :   

A0A8C5THT3_BMF-01          FHRLHIQRHQQNRNQVWWQLFLFLHNLA----------------------
A0A8C5UI47_BCL2L11-01      -----CLVFL-----------SFLFCFVFLPLFQGFLDFQVGNPQVVILR
A0A8C5TVU9_BCL2L11-01      FNASYCPRRV-----------TFLSSLS----------------------
                                                 **  :                       

A0A8C5THT3_BMF-01          LNAEVNRN-HTGQR
A0A8C5UI47_BCL2L11-01      LLRYI-IRLIWRLQ
A0A8C5TVU9_BCL2L11-01      ------IS-LKGKG
                                         

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice