Dataset for protein classical BH3-containing proteins of organism Malurus cyaneus samueli

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5TVU9_BCL2L11      --------------------------------------------------
A0A8C5THT3_BMF-01       MDR-------PSYLEEDYSSLDGLDDDVFHSDDF----------------
A0A8C5UI47_BCL2L11      MGRGAGGRAGPGALGRSPRSAPRRQPDGQAAPEVKARRDGEGGRLPAAEG
                                                                          

A0A8C5TVU9_BCL2L11      --------------------------TYKSNCEFYGVQSVQFVL------
A0A8C5THT3_BMF-01       --------------------GLAGQPGEMTATGFFTQNQSYSCLLGRFQL
A0A8C5UI47_BCL2L11      RARARSCARRPRRLPGPGRPGVAAAAARGPPTGPFATRSPLFIFVRRSPL
                                                     .    :  ..    :      

A0A8C5TVU9_BCL2L11      ------------ALGSNAPTLSHAASR-----------------------
A0A8C5THT3_BMF-01       FPLTHCC-----GPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRR
A0A8C5UI47_BCL2L11      LPRSSSGYFSFEAERSPAPLGCDKATQTPSPPCQALSHCLSAMASR----
                                    .     *     *:.                       

A0A8C5TVU9_BCL2L11      -------WQSHSPAE-----------------EVQPEIWIAQELRRIGD-
A0A8C5THT3_BMF-01       LFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIAD-
A0A8C5UI47_BCL2L11      -------WQSHSPAE-----------------EVQPEIWIAQELSSLLCL
                               :. * *.                  *...*:.**.:*  :   

A0A8C5TVU9_BCL2L11      ------------EFNASYCPRRVT-----------FLSSLSISLK-----
A0A8C5THT3_BMF-01       ------------QFHRLHIQRHQQNRNQVWWQLFLFLHNLALNAEVNRNH
A0A8C5UI47_BCL2L11      VFLSFLFCFVFLPLFQGFLDFQVGNPQVVILRLLRYIIRLIWRLQ-----
                                     :   .   .             ::  *    :     

A0A8C5TVU9_BCL2L11      -GKG
A0A8C5THT3_BMF-01       TGQR
A0A8C5UI47_BCL2L11      ----
                            

© 1998-2022Legal notice