Dataset for protein Bim of organism Macaca nemestrina

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K6E212_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Macaca nemestrina GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPA
DMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6E212_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Macaca nemestrina GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRMSLPPD
© 1998-2020Legal notice