Dataset for protein Bim of organism Macaca nemestrina

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6E212_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2K6E212_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                        *****************************************         

A0A2K6E212_BCL2L11      --------------------------------------------------
A0A2K6E212_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
                                                                          

A0A2K6E212_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A2K6E212_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
                         *************************************************

A0A2K6E212_BCL2L11      ELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A2K6E212_BCL2L11      ELRRIGDEFNAYYARRMSLPPD--------------------------
                        ****************: *                             

© 1998-2020Legal notice