Dataset for protein Puma of organism Macaca nemestrina

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2K6ASP2_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Macaca nemestrina GN=BBC3 (length=261 residues).
IKFGVGSARACPCQVPRASSATWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGC
RPRRPRPAARCLPLRPHRPTRRHRHPGGPPLAWGSPQPAPRPTPGRSSALALAGGAAPGVARAQRPGGPGGRSHPGGPGS
PRGGGTVGPGDRGPAAADGGRPQRAIRAAETRGAAATPPLALEGPVQSHHGTPALTQGPQSPRNGAQLGACTRPVDVRDS
GGRPLPPPDTLASAGDFLCTM
>gnl|bcl2dbpro|A0A2K6ASP2_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Macaca nemestrina GN=BBC3 (length=101 residues).
IKFGVGSARACPCQVPRASSATWVPCQICETRGAAATPPLALEGPVQSHHGTPALTQGPQSPRNGAQLGACTRPVDVRDS
GGRPLPPPDTLASAGDFLCTM
>gnl|bcl2dbpro|A0A2K6ASP2_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Macaca nemestrina GN=BBC3 (length=131 residues).
IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLLLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
© 1998-2021Legal notice