Dataset for protein Puma of organism Macaca nemestrina

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6ASP2_BBC3-01      IKFGVGSARACPCQVPRASSATWVPCQICGPRERHGPRTPGGQLPGARRG
A0A2K6ASP2_BBC3-03      IKFGVGSARACPCQVPRASSATWVPCQICGP-------------------
A0A2K6ASP2_BBC3-02      IKFGVGSARACPCQVPRASSATWVPCQICET-------------------
                        ***************************** .                   

A0A2K6ASP2_BBC3-01      PGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPRPAARCLPLRPHRPT
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-02      --------------------------------------------------
                                                                          

A0A2K6ASP2_BBC3-01      RRHRHPGGPPLAWGSPQPAPRPTPGRSSALALAGGAAPGVARAQRPGGPG
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-02      --------------------------------------------------
                                                                          

A0A2K6ASP2_BBC3-01      GRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRAIRAAETRGAAATPPL
A0A2K6ASP2_BBC3-03      -----------------------------------------QPSLLLAEQ
A0A2K6ASP2_BBC3-02      -----------------------------------------RGAAATPPL
                                                                 . :   .  

A0A2K6ASP2_BBC3-01      ALEGPVQSHHGTPALTQGPQSPRNGA---------QLGACTRPV------
A0A2K6ASP2_BBC3-03      HLESPVPSAPG--ALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
A0A2K6ASP2_BBC3-02      ALEGPVQSHHGTPALTQGPQSPRNGA---------QLGACTRPV------
                         **.** *  *  **: ** ..  *.         ::**  * :      

A0A2K6ASP2_BBC3-01      --DVRDSGGRPLPPPDTLASAGDFLCTM---------------
A0A2K6ASP2_BBC3-03      QYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
A0A2K6ASP2_BBC3-02      --DVRDSGGRPLPPPDTLASAGDFLCTM---------------
                          : * .  .    *..     :::  :               

© 1998-2020Legal notice