Dataset for protein classical BH3-containing proteins of organism Leptobrachium leishanense

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C5QSK2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Leptobrachium leishanense GN=BCL2L11 (length=194 residues).
MAKQPSVLSPDSESGDTDNLQSTSSRPTPHCPLRRGAPTSLNSPFQGSLSNEGGSSSASTPWGTSIPPYSPNSITSRSPH
CMLLRRQSLVSSGYFSFDISPAPLSCDKATQTPSPPCQAVNHLLSAMAAARHPIELHNMSPEIWIAHELRRIGDEFNAAF
AHRRGFPNNRPRAAEQVVILRVLRFLVRLIWRMQ
>gnl|bcl2dbpro|A0A8C5QUK0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Leptobrachium leishanense GN=BAD (length=151 residues).
MAGSVPDTIFSIEKFDSDEQGVFHSSSDPPSTSTCKVSRSSPNLQRQRGKEARFRTESASEPVTETDHVAELRYRSRSRS
APSSVLVAARYGRELRRMSDEFDLTFTGLPRPKSAGAASEMTESKSFKEMFMSFWGRRKSKGKPDSTDETS
>gnl|bcl2dbpro|A0A8C5R6G2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Leptobrachium leishanense GN=BMF (length=185 residues).
MSYRMEQESFLSSDELDDDVFYPDDFEFSLPPLTPPSPFIQKYTSFFGRFHLFPLSHCCGPGCRSADSEDKATQTLGSPS
VSMNAMLPCGVTESPQRLFYGNAGYMLQHPARSPSLLRDHLTRGRQEQSAERRIARKLQCIGDQFHRLHLQKLQQNRNQV
WSQIFFFFRNLVIQNERNRGEVNWR
>gnl|bcl2dbpro|A0A8C5R6G2_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Leptobrachium leishanense GN=BMF (length=181 residues).
MEQESFLSSDELDDDVFYPDDFEFSLPPLTPPSPFIQKYTSFFGRFHLFPLSHCCGPGCRSADSEDKATQTLGSPSVSMN
AMLPCGVTESPQRLFYGNAGYMLQHPARSPSLLRDHLTRGRQEQSAERRIARKLQCIGDQFHRLHLQKLQQNRNQVWSQI
FFFFRNLVIQNERNRGEVNWR
© 1998-2022Legal notice