Dataset for protein classical BH3-containing proteins of organism Leptobrachium leishanense

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5QUK0_BAD-01       -----------MAGSVPDTIFSIEKFDSDEQGVFHSSSDPPSTSTCKVSR
A0A8C5QSK2_BCL2L11      ---MAKQPSVLSPDSESGDT---DNLQ---------STSSRPTPHCPLRR
A0A8C5R6G2_BMF-01       MSYRMEQESFLSSDELDDDVFYPDDFE---------FSLPPLTPPSPFIQ
A0A8C5R6G2_BMF-02       ----MEQESFLSSDELDDDVFYPDDFE---------FSLPPLTPPSPFIQ
                                    ...  .     :.::          : .  *. . . .

A0A8C5QUK0_BAD-01       SSPN---------LQRQRGKEARFR-------------------------
A0A8C5QSK2_BCL2L11      GAPTSLNSPFQGSLSNEGGSSSASTPWGTSIPPYSPNSITSRSPHCMLLR
A0A8C5R6G2_BMF-01       KYTSFFGRFHLFPLSHCCGPGCRSA---------DSEDKATQTLGSPSVS
A0A8C5R6G2_BMF-02       KYTSFFGRFHLFPLSHCCGPGCRSA---------DSEDKATQTLGSPSVS
                          ..         *..  *  .                            

A0A8C5QUK0_BAD-01       ------------------------TESASEPVTETDHVAELRYRSRSRSA
A0A8C5QSK2_BCL2L11      RQSLVSSGYFSFDISPAPLSCDKATQTPSPPCQAVNHLLSAMAAARHPIE
A0A8C5R6G2_BMF-01       MNAMLPCGVTE---SPQRLFYGNAGYMLQHPARSPSLLRDHLTRGR----
A0A8C5R6G2_BMF-02       MNAMLPCGVTE---SPQRLFYGNAGYMLQHPARSPSLLRDHLTRGR----
                                                    . *    . : .    .*    

A0A8C5QUK0_BAD-01       PSSVLVAARYGRELRRMSDEFDLTFTGLPRPKSAGAASEMTESKSFKEMF
A0A8C5QSK2_BCL2L11      LHNMSPEIWIAHELRRIGDEFNAAFAHRRGFPN-------NRPRAAEQV-
A0A8C5R6G2_BMF-01       -QEQSAERRIARKLQCIGDQFHR--LHLQKLQQ-------NRNQVWSQIF
A0A8C5R6G2_BMF-02       -QEQSAERRIARKLQCIGDQFHR--LHLQKLQQ-------NRNQVWSQIF
                          .     . ..:*. :.*:*           .       .  .  .:: 

A0A8C5QUK0_BAD-01       MSFWGR--RKSKGKPDSTDETS
A0A8C5QSK2_BCL2L11      -----VILRVLRFLVRLIWRMQ
A0A8C5R6G2_BMF-01       FFFRNLVIQNERNRGEVNWR--
A0A8C5R6G2_BMF-02       FFFRNLVIQNERNRGEVNWR--
                                .  .          

© 1998-2022Legal notice