Dataset for protein classical BH3-containing proteins of organism Laticauda laticaudata

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C5RCV4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Laticauda laticaudata GN=BAD (length=77 residues).
MEEVGAFRARSRSAPPILWAAQRYGRELRRMSDEFHGLPRPKSAGTCSHMDRPPPSWKDTLRSWWRRSCPENGPSSS
>gnl|bcl2dbpro|A0A8C5RIV9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Laticauda laticaudata GN=PMAIP1 (length=52 residues).
MIVSSMQIGNTVLVCFTECSVAIALQLRRIGDKWNLRQRILNLFSKLFCPGT
>gnl|bcl2dbpro|A0A8C5ST95_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Laticauda laticaudata GN=BMF (length=195 residues).
MDPPVFLEDDFSHLDGLDDDVFHSDDCELVSQSSKMAFRGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRHAKQQDKATQT
LNASSSSQDIMLPCGVTEEPQRLFYGNAGYRLHVQPIGFTLNPHLQEEPQESLQELRTEVQIARKLQCIADQFHRLHLQR
ILKSHCGDFCFPLFHPLVTRFFCHLEYIHPSVTLG
>gnl|bcl2dbpro|A0A8C5STS5_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Laticauda laticaudata GN=BCL2L11 (length=214 residues).
MAKQSPDLNSECEREGGQLQPAERPAQPHHLRPGAPTSLQTEYQGNHLGERDSSSPGSPQGPLAPPSSPSPFATRSPLFM
FVRRSPLLSRSSSGYFSFDIDRSPAPMNCDKATQTPSPPCQAINHYLSAMGKQEHASRWQSRPIPEDMQPEIWIAQELRR
IGDEFNASYCPRRVTFNIFIVLNSFAYSSDGALSTYTKDRGKQMLHLEHLLNYW
>gnl|bcl2dbpro|A0A8C5STS5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Laticauda laticaudata GN=BCL2L11 (length=202 residues).
MAKQSPDLNSECEREGGQLQPAERPAQPHHLRPGAPTSLQTEYQGNHLGERDSSSPGSPQGPLAPPSSPSPFATRSPLFM
FVRRSPLLSRSSSGYFSFDIDRSPAPMNCDKATQTPSPPCQAINHYLSAMGKQEHASRWQSRPIPEDMQPEIWIAQELRR
IGDEFNASYCPRRGLLDYQGVNHQIIILRLLHYIVRFIWRMQ
© 1998-2022Legal notice