Dataset for protein classical BH3-containing proteins of organism Laticauda laticaudata

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5ST95_BMF-01       --------------------------------MDPPVFLEDDF--SHLDG
A0A8C5STS5_BCL2L11      MAKQSPDLNSECEREGGQLQPAERPAQPHHLRPGAPTSLQTEYQGNHLGE
A0A8C5STS5_BCL2L11      MAKQSPDLNSECEREGGQLQPAERPAQPHHLRPGAPTSLQTEYQGNHLGE
A0A8C5RCV4_BAD-01       --------------------------------------------------
A0A8C5RIV9_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C5ST95_BMF-01       LDDDVFHSDDCELVSQSSKMAFRGIFTQSKSYNCLLGRFQLFPLTHCCGP
A0A8C5STS5_BCL2L11      RDSSSPGSPQGPLAPPSSPSPF-------ATRSPLFMFVRRSPLLSRSSS
A0A8C5STS5_BCL2L11      RDSSSPGSPQGPLAPPSSPSPF-------ATRSPLFMFVRRSPLLSRSSS
A0A8C5RCV4_BAD-01       --------------------------------------------------
A0A8C5RIV9_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C5ST95_BMF-01       GSRHAKQQDKATQTLNASSSSQDIMLPCGVTEEPQRLFYGNAGYRLHVQP
A0A8C5STS5_BCL2L11      GY-FSFDIDRSPAPMNCDKATQTPSPPCQAINH----YLSAMGKQEHASR
A0A8C5STS5_BCL2L11      GY-FSFDIDRSPAPMNCDKATQTPSPPCQAINH----YLSAMGKQEHASR
A0A8C5RCV4_BAD-01       --------------------------------------------------
A0A8C5RIV9_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C5ST95_BMF-01       IGFTLNPHLQEEPQESLQELRTEVQIARKLQCIADQFHRLHLQRI-----
A0A8C5STS5_BCL2L11      W----------QSRPIPEDMQPEIWIAQELRRIGDEFNASYCPRRVTFNI
A0A8C5STS5_BCL2L11      W----------QSRPIPEDMQPEIWIAQELRRIGDEFNASYCPRR-----
A0A8C5RCV4_BAD-01       --MEEVGAFRARSRSAPPILWAAQRYGRELRRMSDEFHGLPRPKS-----
A0A8C5RIV9_PMAIP1-      ---MIVSSMQIGNTVLVCFTECSVAIALQLRRIGDKWNLRQR--------
                                                  . :*. :.*:::            

A0A8C5ST95_BMF-01       --------------LKSHCGDFCFPLFH--PLVTRFFCHLEYIHPSVTLG
A0A8C5STS5_BCL2L11      FIVLNSFAYSSDGALSTYTKDRGKQMLHLEHLLNYW--------------
A0A8C5STS5_BCL2L11      ------------GLLDYQGVNHQIIILRLLHYIVRFIWRMQ---------
A0A8C5RCV4_BAD-01       ----------------AGTCSHMDRPPPSWKDTLRSWWRRSCPENGPSSS
A0A8C5RIV9_PMAIP1-      --------------------------------ILNLFSKLFCPGT-----
                                                                          

© 1998-2022Legal notice