Dataset for protein Bad of organism Lates calcarifer

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A4W6EMZ7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Lates calcarifer GN=BAD (length=167 residues).
MAANFTISDSESEASEEVEEGEMNQSSTEQEQQIPQRNTVTLPELRLPVPGRIRLNSESHASTASRDEGLQVRGEEEAGT
PTEGAPFRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDKGEMRRVKSATTTRQMHHSKSWWSYLFSHQETEGENNHHE
NHTHRTE
>gnl|bcl2dbpro|A0A4W6EMZ7_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Lates calcarifer GN=BAD (length=229 residues).
MYRNKCCLVIICMNNVLNVCFPTVVLITVKLSNIDSCTSTYGHFLVYNRVQFLLNLPSPDVTMAANFTISDSESEASEEV
EEGEMNQSSTEQEQQIPQRNTVTLPELRLPVPGRIRLNSESHASTASRDEGLQVRGEEEAGTPTEGAPFRGRSKSAPPAL
WAAKKYGQKLRRMSDEFDSLLDKGEMRRVKSATTTRQMHHSKSWWSYLFSHQETEGENNHHENHTHRTE
© 1998-2020Legal notice