Dataset for protein Bad of organism Lates calcarifer

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      MYRNKCCLVIICMNNVLNVCFPTVVLITVKLSNIDSCTSTYGHFLVYNRV
                                                                         

A0A4W6EMZ7_BAD-01      ------------MAANFTISDSESEASEEVEEGEMNQSSTEQEQQIPQRN
A0A4W6EMZ7_BAD-02      QFLLNLPSPDVTMAANFTISDSESEASEEVEEGEMNQSSTEQEQQIPQRN
                                   **************************************

A0A4W6EMZ7_BAD-01      TVTLPELRLPVPGRIRLNSESHASTASRDEGLQVRGEEEAGTPTEGAPFR
A0A4W6EMZ7_BAD-02      TVTLPELRLPVPGRIRLNSESHASTASRDEGLQVRGEEEAGTPTEGAPFR
                       **************************************************

A0A4W6EMZ7_BAD-01      GRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDKGEMRRVKSATTTRQMHH
A0A4W6EMZ7_BAD-02      GRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDKGEMRRVKSATTTRQMHH
                       **************************************************

A0A4W6EMZ7_BAD-01      SKSWWSYLFSHQETEGENNHHENHTHRTE
A0A4W6EMZ7_BAD-02      SKSWWSYLFSHQETEGENNHHENHTHRTE
                       *****************************

© 1998-2020Legal notice