Dataset for protein classical BH3-containing proteins of organism Ictalurus punctatus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2D0SYM2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Ictalurus punctatus GN=BAD (length=198 residues).
MSNQYLLRLRKARFNFDKEEYTKVINTRIGSEGGGTILNHFFGNSSRITAFTMDETPQSVRGDAGPVDDKESRWSETVEN
TDSPSVGGRVRLYSESQVHTVSRWEDAELQDGISAEESGGASDGAPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLD
RGDIRRVSSPGKVSQKQSNRGWFSFLWGSREEEEEGRE
>gnl|bcl2dbpro|W5UAU7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ictalurus punctatus GN=BMF (length=152 residues).
MDEDEDEVFGPISQCWPSSNREIKQEDHSTQTPGSPAVRLNGMLPCGVAEEPRRLFYGSAGLLLLTPSARTNRVEDAMFP
ENRPRRRPAHSVEAQIGQKLQMIGDQFYQEHMLQHQNQRNQWPFWLRLASALYALLFDGEPAVHRRRQEDRR
>gnl|bcl2dbpro|W5UEE7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ictalurus punctatus GN=BCL2L11 (length=221 residues).
MLFARRRRFFFCPWSPEAVCPRNMSKRQYRADGPAFLKEHGGRGESASRAEPYESPQHRELEVIRGGIALPNSRVAYQSR
SPVFRTLSRSSSGYFSFDSEPSSPLITHSTATQTPSPSSQVITHALQRISKARGDAQNHELWPALLNHYPPHGAASAGDM
QAELEIARELRRIGDEFNQLYFHEAERNGGAARPQAQNEPAIMLWIGLLIGRLLQFFLRQR
© 1998-2020Legal notice