Dataset for protein classical BH3-containing proteins of organism Ictalurus punctatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


W5UAU7_BMF-01          -----------------MDEDEDEVFGPISQCWPSSNREIKQEDHSTQTP
A0A2D0SYM2_BAD-01      MSNQYLLRLRKARFNF----DKEEYTKVINTRIGSEGGGTILNHFFGNSS
W5UEE7_BCL2L11-01      -----MLFARRRRFFFCPWSPEAVCPRNMSKRQYRADGPAFLKEHGGRGE
                                            :      :.      .     : .  .  

W5UAU7_BMF-01          G--------SPAVRLNGMLPCGVAEEPRRLFYGSAGLLLLTPSART----
A0A2D0SYM2_BAD-01      RITAFTMDETPQS-----VRGDAGPVDDKES-RWSETVENTDSPSVGGRV
W5UEE7_BCL2L11-01      SASRAEPYESPQHRELEVIRGGIALPNSRVAYQSRSPVFRTLSRSSSGYF
                                :*       :  . .    .        :  * *       

W5UAU7_BMF-01          -----------------------NRVEDAMFPENRPRRRPAHS-------
A0A2D0SYM2_BAD-01      RLYSESQVHTVSRWEDAELQDGISAEESGGASDGAPFRGRSQSAPAALWK
W5UEE7_BCL2L11-01      SFDSEPSSPLITHSTATQTPSPSSQVITHALQRISKARGDAQN--HELWP
                                              .             *  ::.       

W5UAU7_BMF-01          ------------------VEAQIGQKLQMIGDQFYQEHMLQHQNQRNQWP
A0A2D0SYM2_BAD-01      A-------------------KKYGRQLRRMSDEFDT-WLDRGDIRRVSSP
W5UEE7_BCL2L11-01      ALLNHYPPHGAASAGDMQAELEIARELRRIGDEFNQLYFHEAERNGGAAR
                                            : ..:*. :.*:*    :   : .     

W5UAU7_BMF-01          FWLRLASAL---YALLFDGEPAVHRRRQEDRR
A0A2D0SYM2_BAD-01      GKVSQKQSNRGWFSFLWGSREEEEEGRE----
W5UEE7_BCL2L11-01      PQAQNEPAIMLWIGLLIGRLLQFFLRQR----
                        .     :     .:* .        .     

© 1998-2020Legal notice